PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G19660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 385aa    MW: 40659.3 Da    PI: 6.9769
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G19660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1148.4e-36631291278
                      TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP  12 seakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       ++++yhrrhkvCe+hsk+p v+vsg+e rfCqqCsrfh l efDe+krsCr+rL++hn+rrrk+q+
  OPUNC08G19660.1  63 DKCRDYHRRHKVCEAHSKTPLVVVSGREMRFCQQCSRFHLLAEFDEAKRSCRKRLDGHNRRRRKPQP 129
                      379*************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114128.1249127IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.8E-2763114IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-3363132IPR004333Transcription factor, SBP-box
PfamPF031101.1E-2664126IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MEWDLKMPPA SWELADELEN SGGGGVPPAA AVAASSAAVG GVNVGGGGRQ ECSVDLKLGG  60
LGDKCRDYHR RHKVCEAHSK TPLVVVSGRE MRFCQQCSRF HLLAEFDEAK RSCRKRLDGH  120
NRRRRKPQPD PMNSASYLAS QQGARFSPFS TPRPEASWTG MIKTEESPYY THHQIPLAMS  180
RRQQHFVGST SDGGRRFPFL QEGEISFGTG TGGVPMDQAA AAASVCQPLL KTVAPPPPHD  240
SGGSGSGSKM FSDGGLTQVL DSDCALSLLS APANSSAIDV GGGRMVVQPT EHIPIAQPLI  300
SGLQFGGGSS SSSSAWFTAR PHHQPATGAA VVVSTAGFSC PVVESEQLNT VLTSNDNEMN  360
YNGMFHVGGE GSSDGTSSSL PFSWQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-25521261684squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109126KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1094690.0AK109469.1 Oryza sativa Japonica Group cDNA clone:001-128-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649377.10.0PREDICTED: squamosa promoter-binding-like protein 16
SwissprotQ6YZE80.0SPL16_ORYSJ; Squamosa promoter-binding-like protein 16
TrEMBLA0A0E0LX940.0A0A0E0LX94_ORYPU; Uncharacterized protein
STRINGLOC_Os08g41940.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-35SBP family protein